PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna31836.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 294aa    MW: 33361.5 Da    PI: 7.1227
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna31836.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg W++eEde+l+ +++ +G g+W+++++  g+ R++k+c++rw++yl
  mrna31836.1-v1.0-hybrid 14 RGLWSPEEDEKLLSYITTYGHGCWRKVPEQAGLQRCGKSCRLRWLNYL 61
                             788*******************************************97 PP

2Myb_DNA-binding48.52e-1567111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg +T++E+ l+++++   G++ W+ Ia++++ gRt++++k++w+++
  mrna31836.1-v1.0-hybrid  67 RGGFTPDEENLIIKLHGVVGNR-WAHIAKCLP-GRTDNEIKNYWNSW 111
                              788*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-26664IPR009057Homeodomain-like
PROSITE profilePS5129423.783965IPR017930Myb domain
SuperFamilySSF466891.16E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002496.7E-161461IPR001005SANT/Myb domain
CDDcd001674.24E-111761No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2465116IPR009057Homeodomain-like
SMARTSM007171.2E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129418.95366116IPR017930Myb domain
PfamPF002495.1E-1467111IPR001005SANT/Myb domain
CDDcd001671.17E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGHHYCCKER KVKRGLWSPE EDEKLLSYIT TYGHGCWRKV PEQAGLQRCG KSCRLRWLNY  60
LRPDIKRGGF TPDEENLIIK LHGVVGNRWA HIAKCLPGRT DNEIKNYWNS WIKKKLEKRC  120
SPIITSDDDH HQQYSQMACL NPNNQDQFVN QTFTARPSAY SPIMFEAASL DESTTHANKI  180
NINVQAGQHF PLDVNSNKLL AWILDQHNVQ ALPSTAPFTN MDANLLMPSL IGSSGTTAYN  240
TNMVELESCS NNDEGGHDIS MECLQSRQDL NAVVHSRQQQ PCSNFHSCWD SVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-28141177109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300815.10.0PREDICTED: transcription factor MYB21-like
TrEMBLM5WCE01e-128M5WCE0_PRUPE; Uncharacterized protein
STRINGVIT_02s0025g00320.t011e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41123358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.11e-71myb domain protein 103